1,627 Free Photos of Views Of Japan

cc-zerofiles uploaded by daderotpages with mapsvehicleseacitylandscapeskylinecityscapeboat
Formal outer kimono (uchikake), Japan, view 2, mid to late 20th century, silk, silk floss, silver and gold thread - Textile Museum of Canada - DSC01037
self-published workcc-zero
Formal outer kimono (uchikake), Japan, view 1, mid to late 20th century, silk, silk floss, silver and gold thread - Textile Museum of Canada - DSC01032
self-published workcc-zero
Flickr - Official U.S. Navy Imagery - USS George Washington is in the East China Sea during a trilateral exercise with the Japan Maritime Self Defence Force and Republic of Korea Navy.
vehiclesea
Drawered Handbox with Four-Season Motif and Interior Cosmetic Boxes with Scrolling Floral Designs, view 4, Japan, early Edo period, lacquered wood - Arthur M. Sackler Museum, Harvard University - DSC01118
self-published workboxing
O henro-gi (Buddhist pilgrim's jacket) for Kumano pilgrimage route, Japan, Taisho or Showa period, 1900-1950 AD, stamped cotton, view 2 - Textile Museum, George Washington University - DSC09714
self-published workcc-pd-mark
Japanned tall clock, dial inscribed 'Brown Boston', movement by Gawen Brown, japanning possibly by Thomas Johnston, Boston, 1745-1755, white pine, paint, gesso, gilt, view 1 - Winterthur Museum - DSC01404
18th-century longcase clocksself-published work
Drawered Handbox with Four-Season Motif and Interior Cosmetic Boxes with Scrolling Floral Designs, view 3, Japan, early Edo period, lacquered wood - Arthur M. Sackler Museum, Harvard University - DSC01115
browngold
Drawered Handbox with Four-Season Motif and Interior Cosmetic Boxes with Scrolling Floral Designs, view 2, Japan, early Edo period, lacquered wood - Arthur M. Sackler Museum, Harvard University - DSC01112
browngold
Japanned tall clock, dial inscribed 'Brown Boston', movement by Gawen Brown, japanning possibly by Thomas Johnston, Boston, 1745-1755, white pine, paint, gesso, gilt, view 3 - Winterthur Museum - DSC01410
18th-century longcase clocksself-published work
US Navy 071220-N-2638R-001 Holiday lights illuminate USS Kitty Hawk (CV 63) in celebration of the holiday season
lightnight
Tower city osaka
backgroundskyline
US Navy 021116-N-3236B-011 USS Curtis Wilbur (DDG 54) participates in Exercise Keen Sword 03 off the coast of Southern Japan
shipsea
US Navy 050120-N-2385R-005 First Class Petty Officers check their answer sheets prior to beginning the Chief Petty Officer Exam held at the Harbor View Club on board U.S. Fleet Activities Sasebo, Japan
united states fleet activities sasebo
Back view of Seiun-maru a training ship of Japan agency of Maritime Education and Training for Seafarers(JMETS) at the Osanbashi of Yokohama Port
boatship
View from Keikyu train near Omorikaigan 3
skylinecity
Tokyo Hinode station 2019-04 2
self-published workpages with maps
Mt Hiei Autumn
landscapenature
US Navy 080621-N-5067K-246 The amphibious transport dock ship USS Juneau (LPD 10) approaches
vehicleboat
Tourism bridge building
buildingskyline
US Navy 061113-N-2716P-002 High Speed Vessel Swift (HSV 2) arrives in Yokosuka, Japan, for a routine port visit
boatsea
Fan-shaped tiered incense box with the Eight Views of Omi (Lake Biwa), Japan, Meiji or Taisho period, approx. 1868-1926, lacquered wood with makie, silver - Asian Art Museum of San Francisco - DSC01467
self-published workcc-zero
Writing box and paper boxes with Eight Views of Omi Province, Edo period, 1700s AD, maki-e lacquer - Tokyo National Museum - Tokyo, Japan - DSC08880
self-published workgold
Mount Fuji from Mount Kisokoma 1993-09-12
landscapemountain
US Navy 070318-N-5961C-336 Ships assigned to Ronald Reagan Carrier Strike Group and Japan Maritime Self-Defense Force (JMSDF) steam in formation during a photo exercise (PHOTOEX)
seascapevehicle
Freezing afternoon winter
landscapetravel
Kimono (furisode) probably used as a theatrical costume, view 2, Japan, early to mid 20th century, silk, gold and silver thread, gold dust - Textile Museum of Canada - DSC00869
self-published workcc-zero
US Navy 100113-N-0807W-033 The amphibious transport dock ship USS Denver (LPD 9) rests in her berth at Fleet Activities Sasebo as snow falls over Japan's Kyushu region
snow in japanboat
Tower city osaka
backgroundskyline
View from Nagano Station Higashi Guchi
trafficcity
Kimono (furisode) probably used as a theatrical costume, view 1, Japan, early to mid 20th century, silk, gold and silver thread, gold dust - Textile Museum of Canada - DSC00867
self-published workcc-zero
りんごの国の特急列車
self-published workpages with maps
Drawered Handbox with Four-Season Motif and Interior Cosmetic Boxes with Scrolling Floral Designs, view 1, Japan, early Edo period, lacquered wood - Arthur M. Sackler Museum, Harvard University - DSC01110
browngold
Drawered Handbox with Four-Season Motif and Interior Cosmetic Boxes with Scrolling Floral Designs, view 5, Japan, early Edo period, lacquered wood - Arthur M. Sackler Museum, Harvard University - DSC01120
boxingbrown
Mount Fuji from Hotel Mt Fuji 1994-11-29
landscapenature
US Navy 080728-N-5961C-001 The Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76) prepares to enter Sasebo harbor in Sasebo, Japan for a port call
general views of uss ronald reagan (cvn-76)united states navy images from sasebo
Kumano kumano hongu taisha grand shrine kumano sanzan
autumngrass
Tower city osaka
backgroundskyline
Tower city osaka
backgroundskyline
Front view of Seiun-maru, a training ship of Japan agency of Maritime Education and Training for Seafarers(JMETS) ,at the Osanbashi Pier of Yokohama Port
waterboat
US Navy 090227-N-9928E-156 The Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) transits to its anchoring point in Sasebo Ko, Japan
vehicleboat
View from Keikyu train near Omorikaigan 4
skylinecity
Midland-Square-and-Nagoya-Building-2
skylinecity
USS Theodore Roosevelt operates with the Japan Maritime Self-Defense Force. (22171622769)
vehiclesea
US Navy 090924-N-8335D-320 A tug pulls the dock landing ship USS Tortuga (LSD 46) as she departs Sasebo
waterboat
Tokyo sky tree city tokyo su ka イ tsu ri ー
buildingtravel
Night view of Seiun-maru, a training ship of Japan agency of Maritime Education and Training for Seafarers(JMETS) ,at the Shinko Pier of Yokohama Port
boatship
Zeze station flyover viewing south 20171009
shoppingcity
Buildings on the Sumida River - Chuo, Tokyo, Japan - DSC06277
skylinewater
Mt Hiei evening
landscapenature
Mount Hiei 20191109
landscapenature
Standing Amida Nyorai (Amitabha) by Eisen (1239-unknown), view 1, Kamakura period, dated 1259 (Shoka 3), wood with polychromy - Tokyo National Museum - DSC05706
amitābha statues in japanself-published work
Kimono (furisode) probably used as a theatrical costume, view 3, Japan, early to mid 20th century, silk, gold and silver thread, gold dust - Textile Museum of Canada - DSC00871
orangered
US Navy 081119-N-1644H-103 Carrier Air Wing Five (CVW 5) and Japan Air Self-Defense Force aircraft fly over USS Harpers Ferry (LSD 49)
vehiclesea
USS West Virginia (BB-48) anchored in Sagami Wan, Japan, August 1945
vehiclesea
Standing Amida Nyorai (Amitabha) by Eisen (1239-unknown), view 2, Kamakura period, dated 1259 (Shoka 3), wood with polychromy - Tokyo National Museum - DSC05710
amitābha statues in japanself-published work
Mount Eboshi from Mount Washi 2008-03-23
landscapenature
US Navy 070318-N-5961C-237 Japan Maritime Self Defense Force (JMSDF) ship JS Haruna (DDH 141), USS Russell (DDG 59) and USS Ronald Reagan (CVN 76) steam in formation during a photo exercise (PHOTOEX) between the Ronald Reagan C
general views of uss russell (ddg-59)sea
Tokyo Tower with Taiwan flag illumination 2
skylinecity
Hitara station viewing North
self-published workpassenger train
US Navy 110318-N-GL340-128 The guided-missile destroyer USS Curtis Wilber (DDG 54) is underway off the coast of Japan providing humanitarian assist
mountainboat
Blue navy blue summer
landscapesummer
Statue - Bunka Gakuen University - Shinjuku, Tokyo - DSC04731
bunka gakuen universityself-published work
Promenade of the Kyoto Railway Museum 29
2017 at the kyoto railway museumself-published work
Monju (Manjushri), view 1, c.1750, Japan, unknown artist, bronze with gold highlights - George Walter Vincent Smith Art Museum - DSC03839
self-published workcc-zero
Monju (Manjushri), view 2, c.1750, Japan, unknown artist, bronze with gold highlights - George Walter Vincent Smith Art Museum - DSC03843
self-published workswords
Sun sunbeams wakayama castle
naturespring
Railroad switch Musa station viewing west 20191115
self-published workcc-zero
上越新幹線の窓から_3
skylinecity
Hitara station viewing south
self-published workpassenger train
US Navy 041121-N-0000X-001 Ships of the Forward Deployed Naval Forces sail in formation past Japan's Mount Fuji after the conclusion of ANNUALEX
boatsea
上越新幹線の窓から_2
skylinecity
Mount Hotaka from Mount Yari 1999-08-13
landscaperock
Musa station west bound platform viewing west 20191115
self-published workcc-zero
Mount Norikura and Mount Kasumisawa from Cho 2002-7-12
landscapenature
Musa station viewing from west 20191115
self-published workvehicle
US Navy 100724-N-9500T-646 The Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76) leads a mass formation of ships from Korea, Taiwan, Japan, Singapore, France, Canada, Australia and the U.S. during Rim of the Pacific (RIM
general views of uss ronald reagan (cvn-76)
Uchikake (garment with long hanging sleeves), view 1, Edo period, 18th century, hexagonal pattern, wisteria, and character design on white figured satin ground - Tokyo National Museum - DSC06009
18th-century clothing of japanself-published work
Mount Hien early in a morning 20200427
landscapewater
Kurama station platforms viewing south 20200530
self-published workperspective
US Navy 070123-N-6106R-054 Tugboats assist USS Curtis Wilbur's (DDG 54) departure from Fleet Activities Yokosuka, Japan, Jan. 23
boatship
US Navy 101210-N-9626Y-052 USS John S. McCain (DDG 56) joins a combined formation of twenty-six Japan Maritime Self-Defense Force (JMSDF) and U.S
boatsea
Tarobogu mae station platform viewing from Yokaichi side 20201014
self-published workcc-zero
Ichihara station platform viewing north 20200523
self-published workpages with maps
US Navy 060701-N-8591H-347 USS Kitty Hawk (CV 63) prepares to pull into Otaru, Japan for a port of call following the completion of joint exercise Valiant Shield 2006
vehicleboat
Buildings on the Sumida River - Chuo, Tokyo, Japan - DSC06275
skylinewater
Musa station internal level crossing viewing from west 20191115
self-published workcc-zero
Musa station internal level crossing viewing north 20191115
self-published workvillage
Musa station viewing from east 20191115 south
self-published workvehicle
Musa station station building viewing from plat form 20191115
self-published workcc-zero
Kurama station viewing from south 20200530 12
self-published workpages with maps
US Navy 070317-N-5961C-052 Japan Maritime Self Defense Force (JMSDF) guided missile destroyer JS Myoko (DDG 175) pulls alongside USS Ronald Reagan (CVN 76) for a refueling at sea (RAS)
vehiclesea
US Navy 070318-N-5961C-374 Ships assigned to Ronald Reagan Carrier Strike Group (CCSG 7) and Japan Maritime Self-Defense Force (JMSDF) break away from formation following a photo exercise (PHOTOEX)
carrier strike groupvehicle
US Navy 100724-N-9500T-242 The Nimitz-class aircraft carrier USS Ronald Reagan leads a formation of ships from Korea, Taiwan, Japan, Singapore, France, Canada, Australia and the U.S
vehiclesea
US Navy 100418-N-3215T-185 Ships from Destroyer Squadron (DESRON) 15 and the Japan Maritime Self-Defense Force (JMSDF) Escort Flotilla One are underway in formation during a passing exercise
vehiclesea
US Navy 091117-N-6720T-094 The aircraft carrier USS George Washington (CVN 73) and the Japan Maritime Self-Defense Force helicopter destroyer JS Hyuga (DDH 181) transit the Pacific Ocean
general views of uss george washington (cvn-73)vehicle
Uchikake (garment with long hanging sleeves), view 2, Edo period, 18th century, hexagonal pattern, wisteria, and character design on white figured satin ground - Tokyo National Museum - DSC06011
18th-century clothing of japanself-published work
Mount Kurobegoro from Mount Yari 1995-05-04
landscapemountain
Shugakuin station Yase bound platform viewing from southeast 20200507
self-published workpages with maps
Chayama station viewing from north 20200503
self-published workvehicle
Mount Cho from Mount Hotaka 2002-08-31
landscapenature
601 - 700 of 1,627 Next page
/ 17